123989-BIOTIN

BRAF (Serine/Threonine-protein Kinase B-raf, Proto-oncogene B-Raf, p94, v-Raf Murine Sarcoma Viral Oncogene Homolog B1, BRAF1, RAFB1) (Biotin)

Size

£927.00

SKU:: 123989-BIOTIN
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa346-445 from human BRAF (NP_004324) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 3D2
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Extra Details:: B-Raf, also know as c-Rmil, is a Serine/Threonine protein kinase member of the Raf family which includes Raf-1 and A-Raf. B-Raf is involved in the transduction of mitogenic signals from the cell membrane to the nucleus. Composed of three conserved region (CR1, CR2, CR3) B-Raf is expressed primarily in the brain and in the nervous system. It has been observed that MAPK is activated by B-Raf in response to nerve growth factor. More than 60% of malignant melanomas were found to contain a specific mutation, B-Raf (V599E) the product of which possesses constitutive kinase activity. Mutations in B-Raf have also been identified in lung cancer and non-Hodgkin lymphoma. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: FRPADEDHRNQFGQRDRSSSAPNVHINTIEPVNIDDLIRDQGFRGDGGSTTGLSATPPASLPGSLTNVKALQKSPGPQRERKSSSSSEDRNRMKTLGRRD Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.

Shipping Conditions:: Blue Ice