Bone Morphogenetic Protein 2 (BMP2, BMP-2, Bone Morphogenetic protein 2A, BMP-2A, BMP2A)

Size

£760.00

SKU:: 123983
Application:: WB
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Rabbit
Immunogen:: Full length human BMP2, aa1-396 (AAI48690.1).
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: BMPs (bone morphogenetic proteins) belong to the TGF-beta superfamily of structurally related signaling proteins. Members of this superfamily are widely represented throughout the animal kingdom and have been implicated in a variety of developmental processes. Proteins of the TGF-beta superfamily are disulfide-linked dimers composed of two 12-15kD polypeptide chains. As implied by their name, BMPs initiate, promote and regulate bone development, growth, remodeling and repair. In addition to its osteogenic activity, BMP-2 plays an important role in cardiac morphogenesis. It is also expressed in a variety of tissues such as lung, spleen, brain, liver, prostate ovary and small intestine. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MVAGTRCLLALLLPQVLLGGAAGLVPELGRRKFAAASSGRPSSQPSDEVLSEFELRLLSMFGLKQRPTPSRDAVVPPYMLDLYRRHSGQPGSPAPDHRLERAASRANTVRSFHHEESLEELPETSGKTTRRFFFNLSSIPTEEFITSAELQVFREQMQDALGNNSSFHHRINIYEIIKPATANSKFPVTRLLDTRLVNQNASRWESFDVTPAVMRWTAQGHANHGFVVEVAHLEEKQGVSKRHVRISRSLHQDEHSWSQIRPLLVTFGHDGKGHPLHKREKRQAKHKQRKRLKSSCKRHPLYVDFSDVGWNDWIVAPPGYHAFYCHGECPFPLADHLNSTNHAIVQTLVNSVNSKIPKACCVPTELSAISMLYLDENEKVVLKNYQDMVVEGCGCR Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Shipping Conditions:: Blue Ice