123972
BNIP3 (BCL2 Adenovirus E1B 19kDa Interacting Protein 3, BCL2/adenovirus E1B 19kD Protein Interacting Protein 3, NIP3)
Size
£760.00
- SKU:
- 123972
- Application:
- WB
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Rabbit
- Immunogen:
- Full length human BNIP3, aa1-194 (NP_004043.2).
- Format:
- Supplied as a liquid in PBS, pH 7.2.
- Extra Details:
- BCL2/adenovirus E1B 19kD protein-interacting protein 3 (BNIP3) is a member of the NIP3 family of proteins. As a homodimer, BNIP3 can overcome BCL2 suppression and induce apoptosis. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MSQNGAPGMQEESLQGSWVELHFSNNGNGGSVPASVSIYNGDMEKILLDAQHESGRSSSKSSHCDSPPRSQTPQDTNRASETDTHSIGEKNSSQSEEDDIERRKEVESILKKNSDWIWDWSSRPENIPPKEFLFKHPKRTATLSMRNTSVMKKGGIFSAEFLKVFLPSLLLSHLLAIGLGIYIGRRLTTSTSTF Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Shipping Conditions:
- Blue Ice