123968-APC
BMX (Cytoplasmic Tyrosine-protein Kinase BMX, Bone Marrow Tyrosine Kinase Gene in Chromosome X Protein, ETK, Epithelial and Endothelial Tyrosine Kinase, NTK38) (APC)
Size
£927.00
- SKU:
- 123968-APC
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- 4°C Do Not Freeze
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa150-280 from human BMX (AAH16652) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 3G3
- Format:
- Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).
- Extra Details:
- Etk is a member of the Bruton's tyrosine kinase family. Etk is expressed in a variety of hematopoietic, epithelial and endothelial cells. It participates in multiple signal transduction pathways. Phosphorylation of tyrosine 566 by Src kinase is required for activation of Etk in vivo. In endothelial and epithelial cells, Etk is regulated by FAK through phosphorylation at tyrosine 40. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: ANLHTAVNEEKHRVPTFPDRVLKIPRAVPVLKMDAPSSSTTLAQYDNESKKNYGSQPPSSSTSLAQYDSNSKKIYGSQPNFNMQYIPREDFPDWWQVRKLKSSSSSEDVASSNQKERNVNHTTSKISWEFP Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice