123945-PE
BLMH (Bleomycin Hydrolase, BH, BLM Hydrolase, BMH) (PE)
Size
£914.00
- SKU:
- 123945-PE
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- 4°C Do Not Freeze
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa356-454 from human BLMH with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 4A2
- Format:
- Supplied as a liquid in PBS, pH 7.4. No preservative added. Labeled with R-Phycoerythrin (PE).
- Extra Details:
- BLMH is a member of the peptidase C1 family and exists as a homohexamer. While its normal physiological function is not known, it protects normal and malignant cells from the glycopeptide antitumor drug BLM. It inactivates bleomycin B2 (a cytotoxic glycometallopeptide) by hydrolysis of a carboxyamide bond of beta-aminoalanine and also shows general aminopeptidase activity. The specificity varies but amino acid arylamides of Met, Leu and Ala are preferred. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: NMNKAERLTFGESLMTHAMTFTAVSEKDDQDGAFTKWRVENSWGEDHGHKGYLCMTDEWFSEYVYEVVVDRKHVPEEVLAVLEQEPIILPAWDPMGALA Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice