123934-BIOTIN
BIM (Bcl2-interacting Mediator of Cell Death, BimEL, BimL, BIM-alpha6, BIM-beta6, BIM-beta7, BAM, BCL2-like 11 Apoptosis Facilitator, Bcl-2-like Protein 11, BCL2L11, Bcl2-L-11, BOD) (Biotin)
Size
£927.00
- SKU:
- 123934-BIOTIN
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant protein corresponding to aa1-100 from human BIM with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 2F10
- Format:
- Supplied as a liquid in PBS, pH 7.4. No preservative added. Labeled with Biotin.
- Extra Details:
- Bim belongs to Bcl-2 family of proteins containing Bcl-2 homology domain3 (BH3). It is proapoptotic and exerts its effects by interacting with prosurvival members of the Bcl-2 family like Bcl-2, Bcl-XL and Bcl-w. It exhibits three splice variants; BimL, BimS and BimEL. They all share homology in their C-terminal BH3 domain and are ubiquitously expressed. BimS is the strongest of them with respect to the proapoptotic capacity. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice