BHLHE41 (BHLHB3, Class E Basic Helix-loop-helix Protein 41, bHLHe41, Class B Basic Helix-loop-helix Protein 3, bHLHb3, Differentially Expressed in Chondrocytes Protein 2, Differentially Expressed in Chondrocytes Protein 2, hDEC2, Enhancer-of-split and Hairy-related Protein 1, SHARP-1, DEC2, SHARP1)

Size

£685.00

SKU:: 123926
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa203-283 from human BHLHB3 (NP_110389) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 4H6
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: BHLHE41 may be a transcriptional repressor that represses both basal and activated transcription. Applications: Suitable for use in Immunofluorescence, ELISA and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: CLERAGQKLEPLAYCVPVIQRTQPSAELAAENDTDTDSGYGGEAEARPDREKGKGAGASRVTIKQEPPGEDSPAPKRMKL Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.