123925-ML550
BHLHE40 (BHLHB2, Class E Basic Helix-loop-helix Protein 40, bHLHe40, Class B Basic Helix-loop-helix Protein 2, bHLHb2, Differentially Expressed in Chondrocytes Protein 1, DEC1, Enhancer-of-split and Hairy-related Protein 2, SHARP-2, Stimulated by Retinoic Acid Gene 13 Protein, DEC1, SHARP2, STRA13, FLJ99214) (MaxLight 550)
Size
£914.00
- SKU:
- 123925-ML550
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- 4°C Do Not Freeze
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa130-230 from BHLHB2 (NP_003661) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 5B1
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™550.
- Extra Details:
- MaxLight™550 is a new Yellow-Green photostable dye conjugate comparable to Alexa Fluor™546, 555, DyLight™549 , Cy3™, TRITC and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (550nm); Emission (575nm); Extinction Coefficient 150,000. May function as a transcriptional factor to modulate chondrogenesis in response to the cAMP pathway. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: LSGRNVETGQEMFCSGFQTCAREVLQYLAKHENTRDLKSSQLVTHLHRVVSELLQGGTSRKPSDPAPKVMDFKEKPSSPAKGSEGPGKNCVPVIQRTFAH* Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice