123925-APC

BHLHE40 (BHLHB2, Class E Basic Helix-loop-helix Protein 40, bHLHe40, Class B Basic Helix-loop-helix Protein 2, bHLHb2, Differentially Expressed in Chondrocytes Protein 1, DEC1, Enhancer-of-split and Hairy-related Protein 2, SHARP-2, Stimulated by Retinoic Acid Gene 13 Protein, DEC1, SHARP2, STRA13, FLJ99214) (APC)

Size

£927.00

SKU:: 123925-APC
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: 4°C Do Not Freeze
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa130-230 from BHLHB2 (NP_003661) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 5B1
Format:: Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).
Extra Details:: May function as a transcriptional factor to modulate chondrogenesis in response to the cAMP pathway. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: LSGRNVETGQEMFCSGFQTCAREVLQYLAKHENTRDLKSSQLVTHLHRVVSELLQGGTSRKPSDPAPKVMDFKEKPSSPAKGSEGPGKNCVPVIQRTFAH* Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.