BCL2L10 (Bcl-2-like Protein 10, Bcl2-L-10, Anti-apoptotic Protein NrH, Apoptosis Regulator Bcl-B, BCLB)

Size

£685.00

SKU:: 123884
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa1-92 from BCL2L10 (NP_065129) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 1B11
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Bcl-B (also called Bcl2-L-10) is a novel anti-apoptotic member of the Bcl-2 family. Bcl-B is closest in aa sequence homology to Boo protein. It contains four Bcl-2 homologs. Bcl-B mRNA is widely expressed in adult human tissues. The Bcl-B protein binds to Bcl-2, Bcl-X(L), and Bax but not Bak. Bcl-B suppresses apoptosis induced by Bax, but not by Bak. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MVDQLRERTTMADPLRERTELLLADYLGYCAREPGTPEPAPSTPEAAVLRSAAARLRQIHRSFFSAYLGYPGNRFELVALMADSVLSDSPGP Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.