123867-APC

BCAR3 (Breast Cancer Anti-estrogen Resistance Protein 3, Novel SH2-containing Protein 2, SH2 Domain-containing Protein 3B, NSP2, SH2D3B, UNQ271/PRO308) (APC)

Size

£927.00

SKU:: 123867-APC
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: 4°C Do Not Freeze
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa266-373 from BCAR3 (AAH39895)with GST tag. MW of the GST tag alone is 26kD.
Clone:: 3G4
Format:: Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).
Extra Details:: In breast cancer, the antiestrogen tamoxifen has been prescribed for both primary treatment and the treatment of advanced metastatic disease. Although the drug induces remission in most patients with estrogen receptor-positive disease, all patients eventually develop resistance. van Agthoven et al. (1998) applied an insertional mutagenesis strategy to a breast cancer cell line. Infected cells were subjected to tamoxifen selection, and the resistant clones were screened for a common integration site linked with antiestrogen resistance. By screening a human testis cDNA library with the integration site-specific probe, they obtained a cDNA encoding BCAR3 (breast cancer antiestrogen resistance 3). The deduced 825aa BCAR3 protein contains a putative Src homology 2 (SH2) domain and sequences homologous to yeast CDC48. Northern blot analysis detected abundant expression of a 3.4kb BCAR3 transcript in heart, placenta, skeletal muscle, spleen, prostate, testis, ovary, small intestine, colon, fetal kidney, and several cancer cell lines, but not in nonmalignant breast tissue; a 6kb BCAR3 transcript was also detected in skeletal muscle and heart. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: YGTSPGQAREGSLTKGRPDVAKRLSLTMGGVQAREQNLPRGNLLRNKEKSGSQPACLDHMQDRRALSLKAHQSESYLPIGCKLPPQSSGVDTSPCPNSPVFRTGSEPA Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.

Shipping Conditions:: Blue Ice