BAZ1B (WBSC10, WBSCR10, WBSCR9, WSTF, Tyrosine-protein Kinase BAZ1B, Bromodomain Adjacent to Zinc Finger Domain Protein 1B, Williams Syndrome Transcription Factor, Williams-Beuren Syndrome Chromosomal Region 10 Protein, Williams-Beuren Syndrome Chromosomal Region 9 Protein, hWALp2)

Size

£685.00

SKU:: 123844
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa1384-1484 from BAZ1B (NP_075381) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 5E9
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: This gene encodes a member of the bromodomain protein family. The bromodomain is a structural motif characteristic of proteins involved in chromatin-dependent regulation of transcription. This gene is deleted in Williams-Beuren syndrome, a developmental disorder caused by deletion of multiple genes at 7q11.23. Applications: Suitable for use in ELISA and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: MDFQTVQNKCSCGSYRSVQEFLTDMKQVFTNAEVYNCRGSHVLSCMVKTEQCLVALLHKHLPGHPYVRRKRKKFPDRLAEDEGDSEPEAVGQSRGRRQKK Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.