123818-BIOTIN
BAIAP1 (MAGI1, Membrane-associated Guanylate Kinase, WW and PDZ Domain-containing Protein 1, BAI1-associated Protein 1, BAP-1, Membrane-associated Guanylate Kinase Inverted 1, MAGI-1, Atrophin-1-interacting Protein 3, AIP-3, WW Domain-containing Protein 3, WWP3, Trinucleotide Repeat-containing Gene 19 Protein, AIP3, BAP1, TNRC19) (Biotin)
Size
£927.00
- SKU:
- 123818-BIOTIN
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa761-860 from MAGI1 (NP_004733) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 7B4
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
- Extra Details:
- BAIAP1 is a member of the membrane-associated guanylate kinase homologue (MAGUK) family. Characterized by two WW domains, a guanylate kinase domain, and five PDZ domains, this protein interacts with the cytoplasmic region of BAI1. Together, these proteins may play a role in cell adhesion and signal transduction. Applications: Suitable for use in ELISA, Immunofluorescence and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: SHSTQVLPEFPPAEAQAPDQTDSSGQKKPDPFKIWAQSRSMYENRPMSPSPASGLSKGEREREINSTNFGECPIPDYQEQDIFLWRKETGFGFRILGGN Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice