123817-BIOTIN

BAI2 (Brain-Specific Angiogenesis Inhibitor 2) (Biotin)

Size

£927.00

SKU:: 123817-BIOTIN
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa22-108 from human BAI2 (NP_001694) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 6A12
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Extra Details:: BAI2 is an Orphan-B GPCR with an unknown ligand. Decreased BAI2 expression is correlated with the formation of new blood vessels in a mouse ischemic model. Along with BAI2, there are two other brain-specific angiogenesis inhibitor genes, designated BAI1 and BAI3, which have similar tissue specificities and structures. Alternative splice forms of BAI2 are differentially regulated during development. BAI2 expression has been reported primarily in the brain, but is also identified in heart, skeletal muscle, thymus, ovary, and testis. ESTs have been isolated from B-cell/lung/testis, bone, brain, fetus, heart, melanocyte/uterus/fetal heart, nerve, pineal, and placenta libraries. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: DPAPSACSALASGVLYGAFSLQDLFPTIASGCSWTLENPDPTKYSLYLRFNRQEQVCAHFAPRLLPLDHYLVNFTCLRPSPEEAVAQ Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.

Shipping Conditions:: Blue Ice