BAG1 (BAG Family Molecular Chaperone Regulator 1, BAG-1, BCL-2 Associated Athanogene 1, BCL-2-associated Athanogene 1, BCL2-associated Athanogene, RAP46)

Size

£685.00

SKU:: 123805
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa241-345 from human BAG1 (NP_004314) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 2D3
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Bcl-2-associated athanogene 1 (BAG-1) was first identified as an anti-apoptotic bcl-2-binding protein. Later it was found to bind the molecular chaperones Hsp70 and Hsc70 through its C-terminal sequence (termed the Bag domain), resulting in the inhibition of the refolding activity of these chaperones. It is thought that by binding and inhibiting these molecular chaperones, BAG-1 is able to modulate the expression level of proteins requiring chaperones to fold correctly. One such group of proteins that are affected is glucocorticoid receptors. Other reports have suggested that the level of BAG-1 expression correlates with the aggressiveness of various cancers. Multiple isoforms of BAG-1 are known to exist. Applications: Suitable for use in Immunofluorescence, ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilutions: Immunofluorescence: 35ug/ml Immunohistochemistry (FFPE): 3ug/ml Optimal dilutions to be determined by the researcher. Amino Acid Sequence: EKIADQLEELNKELTGIQQGFLPKDLQAEALCKLDRRVKATIEQFMKILEEIDTLILPENFKDSRLKRKGLVKKVQAFLAECDTVEQNICQETERLQSTNFALAE Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Shipping Conditions:: Blue Ice