BAF57 (SWI/SNF-related Matrix-associated Actin-dependent Regulator of Chromatin Subfamily E Member 1, BRG1-associated Factor 57, SMARCE1)

Size

£685.00

SKU:: 123802
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant protein corresponding to aa75-142 from human SMARCE1 (NM_003079, NP_003070) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 6G11
Format:: Supplied as a liquid in PBS, pH 7.4.
Extra Details:: SMARCE1/BAF57 protein is part of the large ATP-dependent chromatin remodeling complex SWI/SNF, which is required for transcriptional activation of genes normally repressed by chromatin. SMARCE1/BAF57 can bind to 4-way junction DNA (which is thought to mimic the topology of DNA as it enters or exits the nucleosome), either alone or when in the SWI/SNF complex. Applications: Suitable for use in ELISA, Western Blot and Immunoprecipitation. Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: RYSRKVWDQVKASNPDLKLWEIGKIIGGMWRDLTDEEKQEYLNEYEAEKIEYNESMKAYHNSPAYLAY Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.