BACH1 (Transcription Regulator Protein BACH1, BTB and CNC Homolog 1, HA2303)

Size

£685.00

SKU:: 123797
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa396-492 from human BACH1 (NP_996749) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 1B8
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: ubiquitously expressed member of the Bach family of transcription factors. Although its predicted MW is 82kD, it runs anomalously at 110kD in SDS-PAGE. BACH1 forms noncovalent homodimers, and heterodimers with Maf oncoproteins and p53-related proteins. It apparently serves as an architectural component for gene regulatory protein complexes. Human BACH1 is 736 aa in length. It contains a protein-interaction BTB domain (aa 24-127), a DNA-binding motif (aa 562-577), and a Leu-zipper domain (aa 585-607). This molecule should not be confused with Bach1/Fancj/Brip1 helicase. There are two BACH1 splice variants with a 24 and 31aa substitution for aa593-736, respectively. Over aa 133-513, human BACH1 shares 75% aa identity with mouse BACH1. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: HLAKGFWSDICSTDTPCQMQLSPAVAKDGSEQISQKRSECPWLGIRISESPEPGQRTFTTLSSVNCPFISTLSTEGCSSNLEIGNDDYVSEPQQEPC Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Shipping Conditions:: Blue Ice