123797-ML650
BACH1 (Transcription Regulator Protein BACH1, BTB and CNC Homolog 1, HA2303) (MaxLight 650)
Size
£914.00
- SKU:
- 123797-ML650
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- 4°C Do Not Freeze
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa396-492 from human BACH1 (NP_996749) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 1B8
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™650.
- Extra Details:
- MaxLight™650 is a new Far-IR stable dye conjugate comparable to Alexa Fluor™647, DyLight™649, Cy5™ and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (655nm); Emission (676nm); Extinction Coefficient 250,000. ubiquitously expressed member of the Bach family of transcription factors. Although its predicted MW is 82kD, it runs anomalously at 110kD in SDS-PAGE. BACH1 forms noncovalent homodimers, and heterodimers with Maf oncoproteins and p53-related proteins. It apparently serves as an architectural component for gene regulatory protein complexes. Human BACH1 is 736 aa in length. It contains a protein-interaction BTB domain (aa 24-127), a DNA-binding motif (aa 562-577), and a Leu-zipper domain (aa 585-607). This molecule should not be confused with Bach1/Fancj/Brip1 helicase. There are two BACH1 splice variants with a 24 and 31aa substitution for aa593-736, respectively. Over aa 133-513, human BACH1 shares 75% aa identity with mouse BACH1. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: HLAKGFWSDICSTDTPCQMQLSPAVAKDGSEQISQKRSECPWLGIRISESPEPGQRTFTTLSSVNCPFISTLSTEGCSSNLEIGNDDYVSEPQQEPC Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice