B3GNT6 (N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase, I-beta-1,3-N-acetylglucosaminyltransferase, iGnT, Poly-N-acetyllactosamine Extension Enzyme, UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 1, B3GNT1, MGC119334, MGC119336, MGC119337)

Size

£685.00

SKU:: 123780
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa316-416 from human B3GNT6 (NP_006867) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 2H6
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: This gene encodes a member of the beta-1,3-N-acetylglucosaminyltransferase family. This enzyme is a type II transmembrane protein. It is essential for the synthesis of poly-N-acetyllactosamine, a determinant for the blood group i antigen. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: AYVVPWQDPWEPFYVAGGKVPTFDERFRQYGFNRISQACELHVAGFDFEVLNEGFLVHKGFKEALKFHPQKEAENQHNKILYRQFKQELKAKYPNSPRRC Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.