123759-ML650
Aurora A (Serine/Threonine-protein Kinase 6, Aurora Kinase A, Serine/Threonine-protein Kinase Aurora-A, Serine/Threonine-protein Kinase 15, Aurora/IPL1-related Kinase 1, Aurora-related Kinase 1, ARK-1, hARK1, Breast Tumor-amplified Kinase, AURKA, ARK1, AURA, BTAK, STK15, STK6, AIK, MGC34538) (MaxLight 650)
Size
£914.00
- SKU:
- 123759-ML650
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- 4°C Do Not Freeze
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa1-111 from human AURKA (NP_940835) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 5F8
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™650.
- Extra Details:
- MaxLight™650 is a new Far-IR stable dye conjugate comparable to Alexa Fluor™647, DyLight™649, Cy5™ and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (655nm); Emission (676nm); Extinction Coefficient 250,000. Chromosomal segregation during mitosis as well as meiosis is regulated by kinases and phosphatases. The Aurora kinases, members of the Ser/Thr protein kinase family, associate with microtubules during chromosome movement and segregation. Auroria kinase A may play a role in cell cycle regulation during anaphase and/or telophase, in relation to the function of the centrosome/spindle pole region during chromosome segregation. It may be involved in microtubule formation and/or stabilization. This protein has also been postulated to play a key role during tumor development and progression. Aurora kinase A localizes on centrosomes in interphase cells and at each spindle pole in mitosis. It is highly expressed in testis, weakly in skeletal muscle, thymus and spleen, and also highly expressed in colon, ovarian, prostate, neuroblastoma, breast and cervical cancer cell lines. Expression is cell-cycle regulated, low in G1/S, accumulates during G2/M, and decreases rapidly afterward. Defects in Aurora kinase A are responsible for numerical centrosome aberrations including aneuploidy. Applications: Suitable for use in Immunofluorescence, FLISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunofluorescence: 30ug/ml Immunohistochemistry (Formalin fixed paraffin embedded): 6ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: MDRSKENCISGPVKATAPVGGPKRVLVTQQFPCQNPLPVNSGQAQRVLCPSNSSQRIPLQAQKLVSSHKPVQNQKQKQLQATSVPHPVSRPLNNTQKSKQPLPSAPENNP Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice