AURKC (Serine/Threonine-protein Kinase 13, Aurora Kinase C, Aurora/IPL1-related Kinase 3, ARK-3, Aurora-related Kinase 3, Aurora/IPL1/Eg2 Protein 2, Serine/Threonine-protein Kinase Aurora-C, AIE2, AIK3, ARK3, STK13)

Size

£685.00

SKU:: 123758
Application:: WB
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Full length human AURKC, aa1-309 (NP_001015878.1).
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Aurora K-C is a 309aa protein belonging to the Ser/Thr protein kinase family and contains one protein kinase domain. Its association with inner centromere protein (INCENP) and Aurora B activates the novel chromosomal passenger protein that plays a role in organizing microtubules in relation to centrosome:spindle function during mitosis. It also plays a role in the development and progression of cancer especially in the presence of mutated p53. It's highest expression level is during M phase, mostly in testis and some cancer cell lines such as HepG2, HuH7 and HeLa cells. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MSSPRAVVQLGKAQPAGEELATANQTAQQPSSPAMRRLTVDDFEIGRPLGKGKFGNVYLARLKESHFIVALKVLFKSQIEKEGLEHQLRREIEIQAHLQHPNILRLYNYFHDARRVYLILEYAPRGELYKELQKSEKLDEQRTATIIEELADALTYCHDKKVIHRDIKPENLLLGFRGEVKIADFGWSVHTPSLRRKTMCGTLDYLPPEMIEGRTYDEKVDLWCIGVLCYELLVGYPPFESASHSETYRRILKVDVRFPLSMPLGARDLISRLLRYQPLERLPLAQILKHPWVQAHSRRVLPPCAQMAS Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Shipping Conditions:: Blue Ice