ATP9A (Probable Phospholipid-transporting ATPase IIA, ATPase Class II Type 9A, ATPIIA, KIAA0611)

Size

£685.00

SKU:: 123745
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa358-456 from ATP9A (NP_006036) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 3G2
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: ATP + H2O + phospholipid(side 1) = ADP + phosphate + phospholipid(side 2). Applications: Suitable for use in ELISA, Immunofluorescence and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: YSWVIRRDSKIPGTVVRSSTIPEQLGRISYLLTDKTGTLTQNEMIFKRLHLGTVAYGLDSMDEVQSHIFSIYTQQSQDPPAQKGPTLTTKVRRTMSSRV Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.