123737-BIOTIN
ATP6V1G2 (V-type Proton ATPase Subunit G 2, V-ATPase Subunit G 2, V-ATPase 13kD Subunit 2, Vacuolar Proton Pump Subunit G 2, ATP6G, ATP6G2, NG38) (Biotin)
Size
£927.00
- SKU:
- 123737-BIOTIN
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa41-118 from human ATP6V1G2 (NP_569730) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 2E11
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
- Extra Details:
- ATP6V1G2 (ATPase, H+ transporting, lysosomal 13kDa, V1 subunit G2) is a catalytic subunit of the peripheral V1 complex of vacuolar ATPase (V-ATPase). V-ATPase is an heteromultimeric enzyme composed of a peripheral catalytic V1 complex (components A to H) attached to an integral membrane V0 proton pore complex (components: a, c, c', c'' and d). V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: QMEVEQYRREREHEFQSKQQAAMGSQGNLSAEVEQATRRQVQGMQSSQQRNRERVLAQLLGMVCDVRPQVHPNYRISA Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice