123719-PE
ATP6V0D1 (V-type Proton ATPase Subunit D 1, V-ATPase Subunit D 1, 32kD Accessory Protein, V-ATPase 40kD Accessory Protein, V-ATPase AC39 Subunit, p39, Vacuolar Proton Pump Subunit D 1, ATP6D, VPATPD) (PE)
Size
£914.00
- SKU:
- 123719-PE
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- 4°C Do Not Freeze
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa238-309 from ATP6V0D1 (NP_004682) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 2G12
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
- Extra Details:
- Vacuolar ATPase (V-ATPase) is a heteromultimeric enzyme composed of a peripheral catalytic V1 complex (components A to H) attached to an integral membrane V0 proton pore complex (components: a, c, c', c'' and d). V-ATPase is responsible for acidifying a variety of intracellular organelles in eukaryotic cells, thus providing most of the energy required for transport processes in the vacuolar system. ATP6V0D1 is a subunit of the integral membrane V0 complex of vacuolar ATPase. Applications: Suitable for use in FLISA, Immunohistochemistry and Western Blot. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 0.5ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: AKLFPHCGRLYPEGLAQLARADDYEQVKNVADYYPEYKLLFEGAGSNPGDKTLEDRFFEHEVKLNKLAFLN Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice