ATP5J (ATP Synthase-coupling Factor 6, Mitochondrial, ATPase Subunit F6, ATP5A, ATPM)

Size

£685.00

SKU:: 123714
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Full length recombinant corresponding to aa1-108 from human ATP5J (AAH01178) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 1F10
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: ATP synthase, H+ transporting, mitochondrial F0 complex, subunit F6 (ATP5J) is a multisubunit membrane-bound enzyme complex consisting of an F0 segment embedded in the membrane and an F1 segment attached to the F0. It is also a component of mitochondrial ATP synthase which is required for the interactions of the catalytic and proton-translocating segments. Human ATP5J shares 72% sequence identity with rat ATP5J.This import signal peptide is rich in basic amino acids, devoid of acidic amino acids, and amphiphilic, which allows it to be water-soluble yet capable of passage through the phospholipid membrane bilayers. Moreover, it is circulating and functions as an endogenous vasoconstrictor by inhibiting cytosolic phospholipase A2. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MILQRLFRFSSVIRSAVSVHLRRNIGVTAVAFNKELDPIQKLFVDKIREYKSKRQTSGGPVDASSEYQQELERELFKLKQMFGNADMNTFPTFKFEDPKFEVIEKPQA Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Shipping Conditions:: Blue Ice