123705-FITC
ATP4B (Potassium-transporting ATPase Subunit beta, Gastric H(+)/K(+) ATPase Subunit beta, Proton Pump beta Chain) (FITC)
Size
£914.00
- SKU:
- 123705-FITC
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa67-176 from human ATP4B (NP_000696.1) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 1D10
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
- Extra Details:
- The hydrogen/potassium ATPase, or gastric proton pump, belongs to a family of P type cation transporting ATPases. This family of ATPases shares a number of functional and structural similarities including the common feature of consisting of an alpha and beta subunit. Like the ubiquitous sodium/potassium ATPase, the hydrogen/potassium ATPase consists of a large transmembrane catalytic subunit, termed the alpha subunit which contains sites for ATP binding and phosphorylation, and an associated smaller glycoprotein, termed the beta subunit which may play a role in maintaining the structural and functional integrity of the complex. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: DPYTPDYQDQLRSPGVTLRPDVYGEKGLEIVYNVSDNRTWADLTQTLHAFLAGYSPAAQEDSINCTSEQYFFQESFRAPNHTKFSCKFTADMLQNCSGLADPNFGFEEGK Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice