ATP2B1 (Plasma Membrane Calcium-transporting ATPase 1, PMCA1, Plasma Membrane Calcium ATPase Isoform 1, Plasma Membrane Calcium Pump Isoform 1, PMCA1)

Size

£685.00

SKU:: 123699
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant protein corresponding to aa1-97 from human ATP2B1 with GST tag. MW of the GST tag alone is 26kD.
Clone:: 3E2
Format:: Supplied as a liquid in PBS, pH 7.4.
Extra Details:: Calcium-transporting ATPase belongs to the cation transport ATPase (P-type) family and plays a critical role in intracellular calcium homeostasis. Mammalian Calcium-transporting ATPases are encoded by at least four separate genes with multiple isoforms produced by alternative splicing. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: MGDMANNSVAYSGVKNSLKEANHDGDFGITLAELRALMELRSTDALRKIQESYGDVYGICTKLKTSPNEGLSGNPADLERREAVFGKNFIPPKKPKT Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.