123690-APC

ATOH7 (Protein Atonal Homolog 7, Class A Basic Helix-loop-helix Protein 13, bHLHa13, Helix-loop-helix Protein hATH-5, hATH5, ATH5, BHLHA13) (APC)

Size

£927.00

SKU:: 123690-APC
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: 4°C Do Not Freeze
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Recombinant protein corresponding to aa53-99 from human ATOH7 (NP_660161) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 1A5
Format:: Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).
Extra Details:: Transcription factor involved in the differentiation of retinal ganglion cells. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MQGLNTAFDRLRRVVPQWGQDKKLSKYETLQMALSYIMALTRILAEA Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.