123688-PE

ATOH1 (Protein Atonal Homolog 1, Helix-loop-helix Protein hATH-1, Class A Basic Helix-loop-helix Protein 14, bHLHa14, ATOH1, MATH1, HATH1) (PE)

Size

£914.00

SKU:: 123688-PE
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: 4°C Do Not Freeze
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa266-354 from human ATOH1 (NP_005163.1) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 1B12
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Extra Details:: Math1 belongs to the basic helix-loop-helix (BHLH) family of transcription factors. It activates E-box dependent transcription along with E47. It is neural-specific and is switched on during differentiation into neuroectoderm. Applications: Suitable for use in Immunofluorescence, FLISA and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: PTPPGSCRTRFSAPASAGGYSVQLDALHFSTFEDSALTAMMAQKNLSPSLPGSILQPVQEENSKTSPRSHRSDGEFSPHSHYSDSDEAS Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.