ATG5 (Autophagy Protein 5, APG5-like, Apoptosis-specific Protein, APG5L, ASP)

Size

£685.00

SKU:: 123680
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa176-275 from APG5L (AAH02699) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 3D2
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: ATG5 is required for the process of autophagy, an intracellular process for bulk degradation of cytoplasmic components. ATG5 conjugates to ATG12 and associates with isolation membranes to form autophagosomes. The autophagosomes then enclose cytoplasmic components and deliver them to lysosomes/vacuoles to be degraded. ATG5 has been shown to be involved in apoptosis with expression late in the apoptotic process downstream of caspase activity. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: PAEENGFRYIPFRIYQTTTERPFIQKLFRPVAADGQLHTLGDLLKEVCPSAIDPEDGEKKNQVMIHGIEPMLETPLQWLSEHLSYPDNFLHISIIPQPTD Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.