ATF6B (Cyclic AMP-dependent Transcription Factor ATF-6 beta, cAMP-dependent Transcription Factor ATF-6 beta, Activating Transcription Factor 6 beta, ATF6-beta, Protein G13, cAMP Response Element-binding Protein-related Protein, Creb-rp, cAMP-responsive Element-binding Protein-like 1, CREBL1, G13)

Size

£685.00

SKU:: 123672
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa2-88 from human CREBL1 (NP_004372.3) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 4D10
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Transcriptional factor that acts in the unfolded protein response (UPR) pathway by activating UPR target genes induced during ER stress. Binds DNA on the 5'-CCAC[GA]-3' half of the ER stress response element (ERSE) (5'-CCAATN9CCAC[GA]-3') when NF-Y is bound to ERSE. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: AELMLLSEIADPTRFFTDNLLSPEDWGLQNSTLYSGLDEVAEEQTQLFRCPEQDVPFDGSSLDVGMDVSPSEPPWELLPIFPDLQVK Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.