ATF6 (Cyclic AMP-dependent Transcription Factor ATF-6 alpha, cAMP-dependent Transcription Factor ATF-6 alpha, Activating Transcription Factor 6 alpha, ATF6-alpha, Processed Cyclic AMP-dependent Transcription Factor ATF-6 alpha)

Size

£685.00

SKU:: 123671
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa91-194 from ATF6 (AAH14969) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 3D5
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: ATF6, a basic-leucine zipper protein, was isolated by yeast interaction assay as a binding partner to SRF (serum response factor). SRF is a transcription factor, which binds to the serum response element (SRE) in the c-fos promoter and regulates expression of the c-fos gene as well as other immediate-early genes and some tissue-specific genes. ATF6 has also been shown to interact with the endoplasmic reticulum (ER) stress response element (ERSE). ATF6 constitutively expressed as a membrane-bound 90kD protein is directly converted to a 50kD protein in ER-stressed cells. When unfolded proteins accumulate in the ER, ATF6 is cleaved to release its cytoplasmic domain, which enters the nucleus. Applications: Suitable for use in ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: QPLSPASSSYSVSSPRSVDSYSSTQHVPEELDLSSSSQMSPLSLYGENSNSLSSAEPLKEDKPVTGPRNKTENGLTPKKKIQVNSKPSIQPKPLLLPAAPKTQ* Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Shipping Conditions:: Blue Ice