ASCC2 (Activating Signal Cointegrator 1 Complex Subunit 2, ASC-1 Complex Subunit p100, Trip4 Complex Subunit p100, ASC1P100)

Size

£685.00

SKU:: 123611
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa672-758 from human ASCC2 (NP_115580) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 3B2
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Enhances NF-kappa-B, SRF and AP1 transactivation. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: APKPDHFVQDPAVLREKAEARRMAFLAKKGYRHDSSTAVAGSPRGHGQSRETTQERRKKEANKATRANHNRRTMADRKRSKGMIPS Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.