ASAP1 (Arf-GAP with SH3 Domain, ANK Repeat and PH Domain-containing Protein 1, 130kD Phosphatidylinositol 4,5-biphosphate-dependent ARF1 GTPase-activating Protein, ADP-ribosylation Factor-directed GTPase-activating Protein 1, ARF GTPase-activating Protein 1, Development and Differentiation-enhancing Factor 1, DEF-1, Differentiation-enhancing Factor 1, DDEF1, KIAA1249, PIP2-dependent ARF1 GAP)

Size

£685.00

SKU:: 123594
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa1030-1130 from human DDEF1 (NP_060952) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 2G7
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Possesses phosphatidylinositol 4,5-biphosphate-dependent GTPase-activating protein activity for ARF1 (ADP ribosylation factor 1) and ARF5 and a lesser activity towards ARF6. May coordinate membrane trafficking with cell growth or actin cytoskeleton remodeling by binding to both SRC and PIP2. May function as a signal transduction protein involved in the differentiation of fibroblasts into adipocytes and possibly other cell types (By similarity). Applications: Suitable for use in Immunofluorescence, ELISA and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: VQSRDAIQKQASEDSNDLTPTLPETPVPLPRKINTGKNKVRRVKTIYDCQADNDDELTFIEGEVIIVTGEEDQEWWIGHIEGQPERKGVFPVSFVHILSD Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.