ARRB2 (Beta-arrestin-2, Arrestin beta-2, ARB2, ARR2)

Size

£685.00

SKU:: 123570
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa300-409 from human ARRB2 (AAH07427) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 3G1
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Beta-arrestin-2, or ARRB2, is an adaptor protein belonging to the arrestin family with an N- arrestin domain and a C- arrestin domain. ARRB2 is a regulatory protein involved in heterotrimeric G protein-coupled receptor desensitization and is known to regulate beta2-adrenergic receptor (beta2AR) function by enhancing beta2AR mediated nuclear translocation of ERK. ARRB2 binds to phosphorylated beta2ARs, thereby causing a significant impairment of their capacity to activate G(S) proteins. Along with AIP4, ARRB2 acts as an endosomal sorting molecule that mediates CXCR4 entry into a degradative pathway. It may also be involved in hormone-specific desensitization of TSH receptors. ARRB2 is a Ca2+ binding protein of the retinal outer segments and binds to P-rhodopsin and is also involved in synaptic transmission in photoreceptor cells. It is widely expressed in most of the tissues, especially neuronal tissues and spleen. Applications: Suitable for use in Immunofluorescence, ELISA and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: NLASSTIVKEGANKEVLGILVSYRVKVKLVVSRGGDVSVELPFVLMHPKPHDHIPLPRPQSAAPETDVPVDTNLIEFDTNYATDDDIVFEDFARLRLKGMKDDDYDDQLC Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Shipping Conditions:: Blue Ice