123570-ML650
ARRB2 (Beta-arrestin-2, Arrestin beta-2, ARB2, ARR2) (MaxLight 650)
Size
£914.00
- SKU:
- 123570-ML650
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- 4°C Do Not Freeze
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa300-409 from human ARRB2 (AAH07427) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 3G1
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™650.
- Extra Details:
- MaxLight™650 is a new Far-IR stable dye conjugate comparable to Alexa Fluor™647, DyLight™649, Cy5™ and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (655nm); Emission (676nm); Extinction Coefficient 250,000. Beta-arrestin-2, or ARRB2, is an adaptor protein belonging to the arrestin family with an N- arrestin domain and a C- arrestin domain. ARRB2 is a regulatory protein involved in heterotrimeric G protein-coupled receptor desensitization and is known to regulate beta2-adrenergic receptor (beta2AR) function by enhancing beta2AR mediated nuclear translocation of ERK. ARRB2 binds to phosphorylated beta2ARs, thereby causing a significant impairment of their capacity to activate G(S) proteins. Along with AIP4, ARRB2 acts as an endosomal sorting molecule that mediates CXCR4 entry into a degradative pathway. It may also be involved in hormone-specific desensitization of TSH receptors. ARRB2 is a Ca2+ binding protein of the retinal outer segments and binds to P-rhodopsin and is also involved in synaptic transmission in photoreceptor cells. It is widely expressed in most of the tissues, especially neuronal tissues and spleen. Applications: Suitable for use in Immunofluorescence, FLISA and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: NLASSTIVKEGANKEVLGILVSYRVKVKLVVSRGGDVSVELPFVLMHPKPHDHIPLPRPQSAAPETDVPVDTNLIEFDTNYATDDDIVFEDFARLRLKGMKDDDYDDQLC Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice