123570-BIOTIN

ARRB2 (Beta-arrestin-2, Arrestin beta-2, ARB2, ARR2) (Biotin)

Size

£927.00

SKU:: 123570-BIOTIN
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa300-409 from human ARRB2 (AAH07427) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 3G1
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Extra Details:: Beta-arrestin-2, or ARRB2, is an adaptor protein belonging to the arrestin family with an N- arrestin domain and a C- arrestin domain. ARRB2 is a regulatory protein involved in heterotrimeric G protein-coupled receptor desensitization and is known to regulate beta2-adrenergic receptor (beta2AR) function by enhancing beta2AR mediated nuclear translocation of ERK. ARRB2 binds to phosphorylated beta2ARs, thereby causing a significant impairment of their capacity to activate G(S) proteins. Along with AIP4, ARRB2 acts as an endosomal sorting molecule that mediates CXCR4 entry into a degradative pathway. It may also be involved in hormone-specific desensitization of TSH receptors. ARRB2 is a Ca2+ binding protein of the retinal outer segments and binds to P-rhodopsin and is also involved in synaptic transmission in photoreceptor cells. It is widely expressed in most of the tissues, especially neuronal tissues and spleen. Applications: Suitable for use in Immunofluorescence, ELISA and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: NLASSTIVKEGANKEVLGILVSYRVKVKLVVSRGGDVSVELPFVLMHPKPHDHIPLPRPQSAAPETDVPVDTNLIEFDTNYATDDDIVFEDFARLRLKGMKDDDYDDQLC Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.

Shipping Conditions:: Blue Ice