ARR3 (Arrestin-C, Cone Arrestin, C-arrestin, cArr, Retinal Cone Arrestin-3, X-arrestin, ARRX, CAR)

Size

£685.00

SKU:: 123569
Purity:: Purified by Protein A affinity chromatography
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Full length recombinant corresponding to aa1-359 of human ARR3 with GST tag. MW of the GST tag alone is 26kD.
Clone:: 2D7
Format:: Supplied as a liquid in PBS, pH 7.4
Extra Details:: Arrestins and G protein-coupled receptor kinases (GRKs) are key players in homologous desensitization of G protein-coupled receptors. Arrestin-C (Cone arresting/retinal cone arrestin 3) is likely to have a role in retina specific signal transduction, possibly binding to photoactivated phosphorylated red/green opsins. Arrestin-C is expressed in inner and outer segments, and the inner plexiform regions of the retina. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: MSKVFKKTSSNGKLSIYLGKRDFVDHVDTVEPIDGVVLVDPEYFKCRKLFVMLTCAFRYGRDDLEVIGLTFRKDLYVQTLQVVPAESSSPQGPLTVLQERLLHKLGDNAYPFTLQMVTNLPCSVTLQPGPEDAGKPCGIDFEVKSFCAENPEETVSKRDYVRLVVRKVQFAPPEAGPGPSAQTIRRFLLSAQPLQLQAWMDREVHYHGEPISVNVSINNCTNKVIKKIKISVDQITDVVLYSLDKYTKTVFIQEFTETVAANSSFSQSFAVTPILAASCQKRGLALDGKLKHEDTNLASSTIIRPGMDKELLGILVSYKVRVNLMVSCGGILGDLTASDVGVELPLVLIHPKPSYEAAR Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Shipping Conditions:: Blue Ice