123568
ARR3 (Arrestin-C, Cone Arrestin, C-arrestin, cArr, Retinal Cone Arrestin-3, X-arrestin, ARRX, CAR)
Size
£685.00
- SKU:
- 123568
- Application:
- WB
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Full length human ARR3, aa1-359 (AAH12096.1).
- Format:
- Supplied as a liquid in PBS, pH 7.2.
- Extra Details:
- Arrestins and G protein-coupled receptor kinases (GRKs) are key players in homologous desensitization of G protein-coupled receptors. Arrestin-C (Cone arresting/retinal cone arrestin 3) is likely to have a role in retina specific signal transduction, possibly binding to photoactivated phosphorylated red/green opsins. Arrestin-C is expressed in inner and outer segments, and the inner plexiform regions of the retina. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MSKVFKKTSSNGKLSIYLGKRDFVDHVDTVEPIDGVVLVDPEYFKCRKLFVMLTCAFRYGRDDLEVIGLTFRKDLYVQTLQVVPAESSSPQGPLTVLQERLLHKLGDNAYPFTLQMVTNLPCSVTLQPGPEDAGKPCGIDFEVKSFCAENPEETVSKRDYVRLVVRKVQFAPPEAGPGPSAQTIRRFLLSAQPLQLQAWMDREVHYHGEPISVNVSINNCTNKVIKKIKISVDQITDVVLYSLDKYTKTVFIQEFTETVAANSSFSQSFAVTPILAASCQKRGLALDGKLKHEDTNLASSTIIRPGMDKELLGILVSYKVRVNLMVSCGGILGDLTASDVGVELPLVLIHPKPSHEAAR Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Shipping Conditions:
- Blue Ice