ARL6IP1 (ARL6IP, KIAA0069, ADP-ribosylation Factor-like Protein 6-interacting Protein 1)

Size

£685.00

SKU:: 123535
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Full-length recombinant corresponding to aa1-204 from ARL6IP (AAH10281) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 4F9
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: ARL6IP1 may be involved in protein transport, membrane trafficking, or cell signaling during hematopoietic maturation. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MAEGDNRSTNLLAAETASLEEQLQGWGEVMLMADKVLRWERAWFPPAIMGVVSLVFLIIYYLDPSVLSGVSCFVMFLCLADYLVPILAPRIFGSNKWTTEQQQRFHEICSNLVKTRRRAVGWWKRLFTLKEEKPKMYFMTMIVSLAAVAWVGQQVHNLLLTYLIVTSLLLLPGLNQHGIILKYIGMAKREINKLLKQKEKKNE* Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.