ARID3A (AT-rich Interactive Domain-containing Protein 3A, ARID Domain-containing Protein 3A, B Cell Regulator of IgH Transcription, Bright, Dead Ringer-like Protein 1, E2F-binding Protein 1, DRIL1, DRIL3, DRX, E2FBP1)

Size

£685.00

SKU:: 123517
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa317-416 from human ARID3A (NP_005215) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 1A11
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Transcription factor which may be involved in the control of cell cycle progression by the RB1/E2F1 pathway and in B-cell differentiation. Applications: Suitable for use in Immunofluorescence, ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: QYMKYLYPYECEKRGLSNPNELQAAIDSNRREGRRQSFGGSLFAYSPGGAHGMLSSPKLPVSSLGLAASTNGSSITPAPKIKKEEDSAIPITVPGRLPVS Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.