ARID1B (AT-rich Interactive Domain-containing Protein 1B, ARID Domain-containing Protein 1B, BRG1-associated Factor 250b, BAF250B, BRG1-binding Protein hELD/OSA1, Osa Homolog 2, hOsa2, p250R, BAF250B, DAN15, KIAA1235, OSA2)

Size

£685.00

SKU:: 123515
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant corresponding to aa1364-1461 from human ARID1B (NP_059989) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 2D2
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: ARID1B (AT-rich interactive domain-containing protein 1B) is a component of SWI/SNF chromatin remodeling complexes involved in transcriptional activation and repression of select genes by chromatin remodeling. It binds DNA non-specifically and alters DNA-nucleosome topology. Applications: Suitable for use in Immunofluorescence, ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: PPAKRHEGDMYNMQYSSQQQEMYNQYGGSYSGPDRRPIQGQYPYPYSRERMQGPGQIQTHGIPPQMMGGPLQSSSSEGPQQNMWAARNDMPYPYQNR Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.