123515-HRP
ARID1B (AT-rich Interactive Domain-containing Protein 1B, ARID Domain-containing Protein 1B, BRG1-associated Factor 250b, BAF250B, BRG1-binding Protein hELD/OSA1, Osa Homolog 2, hOsa2, p250R, BAF250B, DAN15, KIAA1235, OSA2) (HRP)
Size
£914.00
- SKU:
- 123515-HRP
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa1364-1461 from human ARID1B (NP_059989) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 2D2
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
- Extra Details:
- ARID1B (AT-rich interactive domain-containing protein 1B) is a component of SWI/SNF chromatin remodeling complexes involved in transcriptional activation and repression of select genes by chromatin remodeling. It binds DNA non-specifically and alters DNA-nucleosome topology. Applications: Suitable for use in ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: PPAKRHEGDMYNMQYSSQQQEMYNQYGGSYSGPDRRPIQGQYPYPYSRERMQGPGQIQTHGIPPQMMGGPLQSSSSEGPQQNMWAARNDMPYPYQNR Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice