123515-BIOTIN
ARID1B (AT-rich Interactive Domain-containing Protein 1B, ARID Domain-containing Protein 1B, BRG1-associated Factor 250b, BAF250B, BRG1-binding Protein hELD/OSA1, Osa Homolog 2, hOsa2, p250R, BAF250B, DAN15, KIAA1235, OSA2) (Biotin)
Size
£927.00
- SKU:
- 123515-BIOTIN
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa1364-1461 from human ARID1B (NP_059989) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 2D2
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
- Extra Details:
- ARID1B (AT-rich interactive domain-containing protein 1B) is a component of SWI/SNF chromatin remodeling complexes involved in transcriptional activation and repression of select genes by chromatin remodeling. It binds DNA non-specifically and alters DNA-nucleosome topology. Applications: Suitable for use in Immunofluorescence, ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: PPAKRHEGDMYNMQYSSQQQEMYNQYGGSYSGPDRRPIQGQYPYPYSRERMQGPGQIQTHGIPPQMMGGPLQSSSSEGPQQNMWAARNDMPYPYQNR Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice