ARHGAP4 (ARHGAP 4, C1, KIAA0131, p115, Rho-GAP Hematopoietic Protein C1, RGC1, Rho GTPase-activating Protein 4, RhoGAP 4, RhoGAP4)

Size

£685.00

SKU:: 123489
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant protein corresponding to aa881-986 from human ARHGAP4 with GST tag. MW of the GST tag alone is 26kD.
Clone:: 3F7
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: ARHGAP4 (Rho GTPase-activating protein 4) has an inhibitory effect on stress fiber organization. It is a member of the group of signaling proteins involved in regulation of the small GTP-binding proteins of the RAS superfamily. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: TSPEAMGPSGHRRRCLVPASPEQHVEVDKAVAQNMDSVFKELLGKTSVRQGLGPASTTSPSPGPRSPKAPPSSRLGRNKGFSRGPGAPASPSASHPQGLDTTPKPH Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.