123489-FITC
ARHGAP4 (ARHGAP 4, C1, KIAA0131, p115, Rho-GAP Hematopoietic Protein C1, RGC1, Rho GTPase-activating Protein 4, RhoGAP 4, RhoGAP4) (FITC)
Size
£914.00
- SKU:
- 123489-FITC
- Purity:
- Purified by Protein A affinity chromatography.
- Storage Conditions:
- -20°C
- Supplier:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant corresponding to aa881-986 from human ARHGAP4 (AAH52303) with GST tag. MW of the GST tag alone is 26kD.
- Clone:
- 3F7
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
- Extra Details:
- ARHGAP4 (Rho GTPase-activating protein 4) has an inhibitory effect on stress fiber organization. It is a member of the group of signaling proteins involved in regulation of the small GTP-binding proteins of the RAS superfamily. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: TSPEAMGPSGHRRRCLVPASPEQHVEVDKAVAQNMDSVFKELLGKTSVRQGLGPASTTSPSPGPRSPKAPPSSRLGRNKGFSRGPGAPASPSASHPQGLDTTPKPH Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Shipping Conditions:
- Blue Ice