ARHGAP35 (Rho GTPase-activating Protein 35, Glucocorticoid Receptor DNA-binding Factor 1, Glucocorticoid Receptor Repression Factor 1, GRF-1, Rho GAP p190A, p190-A, GRF1, GRLF1, KIAA1722)

Size

£685.00

SKU:: 123487
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Full length recombinant corresponding to aa1-36 from human GRLF1 (AAH03514) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 4D4-F8
Format:: Supplied as a liquid in PBS, pH 7.2.
Extra Details:: Represses transcription of the glucocorticoid receptor by binding to the cis-acting regulatory sequence 5'-GAGAAAAGAAACTGGAGAAACTC-3'. May participate in the regulation of retinal development and degeneration. May transduce signals from p21-ras to the nucleus, acting via the ras GTPase-activating protein (GAP). May also act as a tumor suppressor. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MEATSRSVHGDVGEVGHFEGMAVCWCPRRGILPGLR Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.