123487-BIOTIN

ARHGAP35 (Rho GTPase-activating Protein 35, Glucocorticoid Receptor DNA-binding Factor 1, Glucocorticoid Receptor Repression Factor 1, GRF-1, Rho GAP p190A, p190-A, GRF1, GRLF1, KIAA1722) (Biotin)

Size

£927.00

SKU:: 123487-BIOTIN
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Full length recombinant corresponding to aa1-36 from human GRLF1 (AAH03514) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 4D4-F8
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Extra Details:: Represses transcription of the glucocorticoid receptor by binding to the cis-acting regulatory sequence 5'-GAGAAAAGAAACTGGAGAAACTC-3'. May participate in the regulation of retinal development and degeneration. May transduce signals from p21-ras to the nucleus, acting via the ras GTPase-activating protein (GAP). May also act as a tumor suppressor. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MEATSRSVHGDVGEVGHFEGMAVCWCPRRGILPGLR Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.