123487-APC

ARHGAP35 (Rho GTPase-activating Protein 35, Glucocorticoid Receptor DNA-binding Factor 1, Glucocorticoid Receptor Repression Factor 1, GRF-1, Rho GAP p190A, p190-A, GRF1, GRLF1, KIAA1722) (APC)

Size

£927.00

SKU:: 123487-APC
Application:: FLISA
Purity:: Purified by Protein A affinity chromatography.
Storage Conditions:: 4°C Do Not Freeze
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Full length recombinant corresponding to aa1-36 from human GRLF1 (AAH03514) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 4D4-F8
Format:: Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).
Extra Details:: Represses transcription of the glucocorticoid receptor by binding to the cis-acting regulatory sequence 5'-GAGAAAAGAAACTGGAGAAACTC-3'. May participate in the regulation of retinal development and degeneration. May transduce signals from p21-ras to the nucleus, acting via the ras GTPase-activating protein (GAP). May also act as a tumor suppressor. Applications: Suitable for use in FLISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MEATSRSVHGDVGEVGHFEGMAVCWCPRRGILPGLR Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.