ARF6 (ADP-ribosylation Factor 6)

Size

£698.00

SKU:: 123465
Purity:: Ascites
Storage Conditions:: -20°C
Supplier:: United States Biological
Host:: Mouse
Immunogen:: Full length recombinant corresponding to aa1-175 from human ARF6 (AAH08918) with GST tag. MW of the GST tag alone is 26kD.
Clone:: 2A4
Format:: Supplied as a liquid in ascites fluid.
Extra Details:: ADP-Ribosylation Factor 6 (ARF6) is a GTP-binding protein that functions as a regulator of cytoskeleton remodeling and endocytic recycling. ARF6 is an allosteric activator of cholera toxin catalytic subunit, an ADP-ribosyltransferase. It may also be involved in the modulation of vesicle budding and uncoating with the Golgi apparatus. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MGKVLSKIFGNKEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTSNYKS Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.